PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P14160_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 26465.2 Da    PI: 9.766
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P14160_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.55.5e-31958150
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                            krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs++g+lyey+
  GSMUA_Achr10P14160_001  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSTRGRLYEYA 58
                            79***********************************************8 PP

2K-box106.33.7e-35821739100
                   K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                             l+  +a+++q e+akL+++i+n+q+++R+l+Ge L+s+sl++L+qLe++Lek+++kiR+kKnell+++ie++qk+e elq++n++Lr
  GSMUA_Achr10P14160_001  82 LSVVNAQHYQLESAKLRQQINNIQSTNRNLMGEALSSMSLRDLKQLENKLEKGISKIRTKKNELLHAEIEYMQKREMELQNDNMYLR 168
                             778899********************************************************************************* PP

                   K-box  96 kklee 100
                             +k+ e
  GSMUA_Achr10P14160_001 169 NKITE 173
                             **976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.866161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.03E-32274IPR002100Transcription factor, MADS-box
CDDcd002653.96E-44275No hitNo description
PRINTSPR004041.0E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014867.6E-2787171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.84787177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALVVFST RGRLYEYANS  60
SVKATIERYK KACSDTTGTG SLSVVNAQHY QLESAKLRQQ INNIQSTNRN LMGEALSSMS  120
LRDLKQLENK LEKGISKIRT KKNELLHAEI EYMQKREMEL QNDNMYLRNK ITENERAQQQ  180
INMLPSTSEY EILTPFDSRN FLQVLQPSQD YSHPQRTALQ LGSIQCFCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q6e-21169169Myocyte-specific enhancer factor 2B
1tqe_R6e-21169169Myocyte-specific enhancer factor 2B
1tqe_S6e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009421278.11e-163PREDICTED: MADS-box transcription factor 3-like
SwissprotQ407041e-117MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLM0RI421e-170M0RI42_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P14160_0011e-169(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-104MIKC_MADS family protein